PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID PDK_30s889841g001
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Arecales; Arecaceae; Coryphoideae; Phoeniceae; Phoenix
Family NAC
Protein Properties Length: 130aa    MW: 15432.8 Da    PI: 9.0484
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PDK_30s889841g001genomePDKView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM171.42.9e-5361251128
                NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkev 92 
                        lppGfrFhPtd+elv +yLk+kveg k+el evi+ +d+yk+ePw+Lp      + ew+fF+ rd+ky++g+r+nrat+sgyWkatg+d++v
  PDK_30s889841g001   6 LPPGFRFHPTDDELVGYYLKRKVEGLKIEL-EVIPVIDLYKFEPWELP------DMEWFFFCLRDRKYPNGSRTNRATESGYWKATGRDRKV 90 
                        79****************************.99**************9......579*********************************** PP

                NAM  93 lskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                        ++ ++++ gl+ktLvfy+grap ge+tdWvmheyrl
  PDK_30s889841g001  91 VC-ESSVHGLRKTLVFYRGRAPGGERTDWVMHEYRL 125
                        **.9999***************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.71E-563128IPR003441NAC domain
PROSITE profilePS5100553.4636130IPR003441NAC domain
PfamPF023657.6E-307125IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 130 aa     Download sequence    Send to blast
MSPMSLPPGF RFHPTDDELV GYYLKRKVEG LKIELEVIPV IDLYKFEPWE LPDMEWFFFC  60
LRDRKYPNGS RTNRATESGY WKATGRDRKV VCESSVHGLR KTLVFYRGRA PGGERTDWVM  120
HEYRLLHAFL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3ulx_A2e-50412513140Stress-induced transcription factor NAC1
Search in ModeBase
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008786297.13e-86PREDICTED: NAC domain-containing protein 71-like
SwissprotQ9FFI51e-64NAC86_ARATH; NAC domain-containing protein 86
TrEMBLA0A0D9XMS23e-75A0A0D9XMS2_9ORYZ; Uncharacterized protein
TrEMBLM0SVB58e-75M0SVB5_MUSAM; Uncharacterized protein
STRINGGSMUA_Achr5P03360_0012e-74(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP62093854
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17980.11e-69NAC domain containing protein 71